PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00067391001
Common NameGSBRNA2T00067391001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 349aa    MW: 39105.7 Da    PI: 7.0238
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00067391001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like971.4e-30194249156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k r++W++eLH+rF++ ++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00067391001 194 KHRRCWSHELHRRFLNTLKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 249
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.861191251IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-26192252IPR009057Homeodomain-like
SuperFamilySSF466899.41E-17192252IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-26194249IPR006447Myb domain, plants
PfamPF002491.3E-5196247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MINSLSNMKN YNEKRVRCCE YIKALEEERR KINVFQRELP LCLELVTQAI ETYKKEISEP  60
TMENLCGQSE CSEQTTGECG GILDLFRPIK HSSTSLEGEE EEVDVDDEHE SNETGLDCDD  120
KNMKSEWLKS VQLWNQPDSV LSNKLERSQQ ETETVVEAIN GNDNGTTISG RQKMEAEKDI  180
SGGSGGSGGI GRRKHRRCWS HELHRRFLNT LKQLGGPHVA TPKQIRELMK VDGLTNDEVK  240
SHLQKYRLHT RRPGQTIPNK RDSQTQHFVV VGGIWVPQAS HSTANAATAG ETTIGIYGPL  300
QSEWPSQSNF GRTISEERSR CSNKGIIRCS SPAMSSSTRT KTKDPKLS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.46430.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00067391001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609905.10.0PREDICTED: two-component response regulator ARR10-like
TrEMBLA0A078HQZ30.0A0A078HQZ3_BRANA; BnaC09g21560D protein
STRINGBra017349.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136001827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25790.11e-166G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]